PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopim01g103840.0.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family ZF-HD
Protein Properties Length: 85aa    MW: 9529.72 Da    PI: 6.772
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopim01g103840.0.1genomeCSHLView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer54.72.4e-171164458
         ZF-HD_dimer  4 vrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreve 58
                        v+Y eC++N Aa+  g+++DG gEf+p+ g+  t + + CaA  CH nFH++ ++
  Sopim01g103840.0.1 11 VKYLECRHNYAARSNGYVLDGYGEFCPT-GAPETLEFFICAAWHCHQNFHKKVEV 64
                        79*************************9.66679*****************9865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257743.0E-81159IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047708.8E-171163IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015664.3E-151261IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152316.5761362IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Sequence ? help Back to Top
Protein Sequence    Length: 85 aa     Download sequence    Send to blast
MASNNNKHFL VKYLECRHNY AARSNGYVLD GYGEFCPTGA PETLEFFICA AWHCHQNFHK  60
KVEVEVENKV ESPVISINPS HGTC*
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755131e-138HG975513.1 Solanum lycopersicum chromosome ch01, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015088823.15e-44PREDICTED: zinc-finger homeodomain protein 4-like
TrEMBLK4B1V93e-58K4B1V9_SOLLC; Uncharacterized protein
STRINGSolyc01g103840.1.11e-57(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA2648622
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G18350.14e-12homeobox protein 24